PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g36730.2.p
Common NameBRADI_2g36730, LOC100837565
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 403aa    MW: 44211.3 Da    PI: 6.2855
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g36730.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.54e-103361548
                      HHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding 15 avkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       ++++G g+W+++++  g+ R++k+c++rw +yl
  Bradi2g36730.2.p  3 HITKHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 36
                      589*****************************97 PP

2Myb_DNA-binding43.47.7e-144285146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                      rg++ ++E++l++++++ lG++ W+ Ia+ m+ gRt++++k+ w++
  Bradi2g36730.2.p 42 RGAFAQDEEDLIIELHAVLGNR-WSQIAAQMP-GRTDNEIKNLWNS 85
                      79999*****************.*********.*********9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.067136IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.0E-15243IPR009057Homeodomain-like
SMARTSM0071726238IPR001005SANT/Myb domain
SuperFamilySSF466891.67E-21383IPR009057Homeodomain-like
PfamPF002499.2E-8436IPR001005SANT/Myb domain
CDDcd001679.38E-5436No hitNo description
PROSITE profilePS5129424.0973791IPR017930Myb domain
SMARTSM007179.8E-124189IPR001005SANT/Myb domain
PfamPF002492.3E-124285IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-244491IPR009057Homeodomain-like
CDDcd001671.37E-84787No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009733Biological Processresponse to auxin
GO:0010089Biological Processxylem development
GO:0010119Biological Processregulation of stomatal movement
GO:0010214Biological Processseed coat development
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MNHITKHGHG CWSSVPKLAG LQRCGKSCRL RWINYLRPDL KRGAFAQDEE DLIIELHAVL  60
GNRWSQIAAQ MPGRTDNEIK NLWNSSLKKK LRQKGIDPNT HKPLTEVDRS GAAPTISTER  120
TSGSSDVNPS SAGALGNFSH LLSETAQSSM LLPVYDKKRP ETASLARPKV PAKELFLDQL  180
TAGHESPSSC RSSGPTLYFP FQQPLGYSNE CGNGDGANMN SLWFNQNDFN CSTISTMMPT  240
VSPSALSTSM GLNLPPDNHR HGGTGISSAP FYWDGVNPSS SGSTGSSGSN SMGFEPQSTN  300
SILENSVFPW TDIGQEKDTR VQLVEELKWP DLLHGTFAEA TTALQNQSQS LYDDVIKAES  360
QFNMEGICAS WFQNQPPQQQ LQAPSDMYDK DLQRMPLSFE HM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-2249122108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18692LKKKLRQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00134DAPTransfer from AT1G09540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN8573100.0JN857310.1 Triticum aestivum cultivar Shannong0431 MYB75 (MYB75) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014755157.10.0PREDICTED: transcription factor MYB46-like isoform X2
TrEMBLA0A0Q3GAU50.0A0A0Q3GAU5_BRADI; Uncharacterized protein
STRINGBRADI2G36730.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.17e-59myb domain protein 61